mgrf1-29 or cjc-1295

[rradam]

There was a thread addressing this, but I cannot find it. Which is better to combine with ghrp?


TIA

 

[rradam]

To further add, I mean cjc 125 w/o dac sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (tetra mod)

vs. mgrf1-29 (cjc1293) sequence Y(d-A)DAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (single mod)

 

[heavyhitter]

according to the science, the mod should be better since it follows the natural growth hormone pulsatile patern. But in research, I know lots of people really like the dac. The thread your looking for I think is the one by Johnjuanb1

 

[rradam]

Still couldn't find the post I was looking for.

from what I can tell, in terms of length, for my source anyway, it looks like half life from shortest to longest is 1293>1295w/o dac>1295w/dac.

I defintely know I dont want w/dac, but I'm looking for that ~30min half life for a pulse.

I'm thinking I want the 1295 w/o dac.

 

[rradam]

Yep, read some more posts, pretty sure 1295 w/o dac is what I'm aiming for. It just sucks that no one sources nomenclature is consistent.

 

[heavyhitter]

most of the 1295 w/o dac your gonna find is actually mod-grf. I hear you about the nomenclature thing. From what i understand taking huperzine a( an ecetylcholinisterase inhibitor) is supposed to help prolong the pulse from mod-grf.

 

[sammy555]

Yep, read some more posts, pretty sure 1295 w/o dac is what I'm aiming for. It just sucks that no one sources nomenclature is consistent.

1295 wo dac Is just a name given to mod grf because people were more familiar with the name cjc. it made it more sellable for peptide companies rather than having to educate people on what mid was. Cjc is an abriviation of the company's name who developed dac. Just get mod or wo dac they will be the same

Sent from my GT-I9300 using Tapatalk 2

 

[rradam]

Yea, thats the confusing part, modgrf usually is called cjc1295 wo dac, but this place has a separate product, called modgrf 1-29/cjc-1293. They also have the regular grf 1-29, and cjc w dac.