There was a thread addressing this, but I cannot find it. Which is better to combine with ghrp?
TIA
To further add, I mean cjc 125 w/o dac sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (tetra mod)
vs. mgrf1-29 (cjc1293) sequence Y(d-A)DAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (single mod)
Still couldn't find the post I was looking for.
from what I can tell, in terms of length, for my source anyway, it looks like half life from shortest to longest is 1293>1295w/o dac>1295w/dac.
I defintely know I dont want w/dac, but I'm looking for that ~30min half life for a pulse.
I'm thinking I want the 1295 w/o dac.
TIA
To further add, I mean cjc 125 w/o dac sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (tetra mod)
vs. mgrf1-29 (cjc1293) sequence Y(d-A)DAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (single mod)
Still couldn't find the post I was looking for.
from what I can tell, in terms of length, for my source anyway, it looks like half life from shortest to longest is 1293>1295w/o dac>1295w/dac.
I defintely know I dont want w/dac, but I'm looking for that ~30min half life for a pulse.
I'm thinking I want the 1295 w/o dac.