- Joined
- Mar 6, 2009
- Messages
- 26,330
You look like a serious and reliable person, I would love if you was available to try mecasermin for me, I would send 4 bottles 10 mg free for you when i receive
I would love to give it a try.
You look like a serious and reliable person, I would love if you was available to try mecasermin for me, I would send 4 bottles 10 mg free for you when i receive
I would love to give it a try.
Perfect, just ready to contact you with a PM!
What protocol would you recommend?
I have Meditrope HGH and Novalin R insulin for synergy but there are so many theories on how to stack the 3.
Guys, post up protocol ideas and the reasoning behind it please...
The Chinese are experts in peptide production. I’m ising Chinese Meditrope HGH right now and it’s as good as any HGH I’ve used.
Don’t be so racist. that was a joke by the way.
you made me laugh
still I trust pharm stuff for something so sensitive....
but true I have been PROVIDERED for years with some good quality chinese growth
those blacks are fucking AWESOME
I recommend 1mg/day igf-1 , 10 iu day/gh , 5 iu novalin r after each meal intramuscular, 100 iu lantus subq after breakfast
I've had many requests of increlex... I told a large peptide research firm that it could produce. They said no problem. I sent them the amino acid sequence. By Next month we should have it and test it. total 100 vial of 10 mg mecasermin. Increlex is 1 vial 40mg mecasermin
Protein chemical formula
C331H518N94O101S7
Protein average weight
7649.0 Da
Sequences
Mecasermin
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA
I've had many requests of increlex... I told a large peptide research firm that it could produce. They said no problem. I sent them the amino acid sequence. By Next month we should have it and test it. total 100 vial of 10 mg mecasermin. Increlex is 1 vial 40mg mecasermin
Protein chemical formula
C331H518N94O101S7
Protein average weight
7649.0 Da
Sequences
Mecasermin
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA
In terms of growth I have heard increlex is what is being used amongst a perfect BB lifestyle over in Kuwait etc.
I trust the information of the source 110%.
Not that will make any difference to people thought or opinion on here I imagine but thought I would contribute [emoji3]
Sent from my iPhone using Tapatalk
If I may tray back the first main topic here -
The issue with IGF1-lr3 is that there are no clinical trials in humans, having said that there are clear evidence for its superiority to IGF1 on mammals studies such as the one below. The IGF1 role and effect (both systemic and locally) is quite identical in all mammals so it'll e safe to conclude from these studies on the clear advantage of the IGF1-lr3 on the Increlex, not to mention that it's much much more price competitive as requires like 100 folds lower dosage
https://www.ncbi.nlm.nih.gov/pubmed/18567600 -
- You may learn as explained before by Rambostalone that the IGF-lr3 higher effect stems from much lower affinity to the IGFBP which enables much longer half life and much superior ability to interact with the IGF1 (and insulin) receptors
- There is in vivo clear evidence for a superior effect of the IGF1-lr3 on regular IGF1 treatment - "In contrast to the mechanism of protection conferred by administration of IGF-I, the protection conferred by LR IGF-I was independent of changes in muscle fatigue and oxidative metabolism. This study further indicates that modulation of IGF-I signalling has therapeutic potential for muscular diseases."
In terms of growth I have heard increlex is what is being used amongst a perfect BB lifestyle over in Kuwait etc.
I trust the information of the source 110%.
Not that will make any difference to people thought or opinion on here I imagine but thought I would contribute [emoji3]
Sent from my iPhone using Tapatalk
Im in the medical industry. I believe last time i looked up my direct cost it was over $10k/mg lol. I hope its worth it.All talk about it, and keep it secret, what do you think?